TCP1 alpha/CCTA anticorps (C-Term)

N° du produit ABIN3043417

Détail du produit anti-TCP1 alpha/CCTA anticorps

Antigène: TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))

Épitope: AA 515-551, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCP1 alpha/CCTA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KFATEAAITI LRIDDLIKLH PESKDDKHGS YEDAVHS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: t-complex 1
Protein Name: T-complex protein 1 subunit alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-TCP1 alpha/CCTA (ABIN3043417)

Gong, Guo, Huang, Sun: "Inhaled nitric oxide alleviates hyperoxia suppressed phosphatidylcholine synthesis in endotoxin-induced injury in mature rat lungs." dans: Respiratory research, Vol. 7, pp. 5, (2006) (PubMed).

Détails sur TCP1 alpha/CCTA

Antigène: TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))

Autre désignation: TCP1 (TCP1 Produits)

Synonymes: anticorps CCT-alpha, anticorps CCT1, anticorps CCTa, anticorps D6S230E, anticorps TCP-1-alpha, anticorps AI528772, anticorps CCT, anticorps Cct1, anticorps Ccta, anticorps TRic, anticorps Tcp-1, anticorps Tp63, anticorps c-cpn, anticorps p63, anticorps TRiC, anticorps CCTalpha, anticorps BEST:GH05123, anticorps CG5374, anticorps Dmel\\CG5374, anticorps T-cpl, anticorps TCP-1alpha, anticorps TCPA_DROME, anticorps Tcp1, anticorps Tcp1-alpha, anticorps gh05123, anticorps cct-alpha, anticorps ccta, anticorps tcp1, anticorps tcp1-a, anticorps tcp1a, anticorps tcp1alpha, anticorps CHUNP6875, anticorps fa13h08, anticorps wu:fa13h08, anticorps wu:fc95g06, anticorps t-complex 1, anticorps T-complex protein 1 subunit alpha, anticorps t-complex protein 1, anticorps Tcp1-like, anticorps t-complex 1 S homeolog, anticorps TCP1, anticorps cct-1, anticorps Tcp1, anticorps T-cp1, anticorps tcp1.S, anticorps tcp1

Sujet: T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

Synonyms: AI528772 antibody|c-cpn antibody|CCT alpha antibody|CCT antibody|CCT-alpha antibody|CCT1 antibody|Ccta antibody|CCTalpha antibody| D6S230E antibody|MGC133746 antibody|p63 antibody|T complex 1 antibody|T complex protein 1 alpha subunit antibody|T complex protein 1 antibody|T-complex homolog TCP1 antibody|T-complex protein 1 subunit alpha antibody|T-complex protein 1 subunit alpha B antibody| Tailless complex polypeptide 1 antibody|Tailless complex polypeptide 1A antibody|Tailless complex polypeptide 1B antibody|TCP 1 alpha antibody|Tcp-1 antibody|TCP-1-alpha antibody|TCP1 antibody|TCPA_HUMAN antibody|Tp63 antibody|TRic antibody

ID gène: 6950

UniProt: P17987