CD36 anticorps (N-Term)

N° du produit ABIN3043804

Détail du produit anti-CD36 anticorps

Antigène: CD36

Épitope: AA 31-66, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD36 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DLLIQKTIKK QVVLEEGTIA FKNWVKTGTE VYRQFW

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: CD36 Molecule (thrombospondin receptor)
Protein Name: Platelet glycoprotein 4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CD36

Antigène: CD36

Autre désignation: CD36 (CD36 Produits)

Synonymes: anticorps BDPLT10, anticorps CHDS7, anticorps FAT, anticorps GP3B, anticorps GP4, anticorps GPIV, anticorps PASIV, anticorps SCARB3, anticorps Fat, anticorps Scarb3, anticorps GPIIIB, anticorps PAS-4, anticorps zgc:92513, anticorps CD36 molecule, anticorps CD36 molecule (thrombospondin receptor), anticorps CD36, anticorps Cd36, anticorps cd36

Sujet: CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.

Synonyms: Adipocyte membrane protein antibody|CD36 antibody|CD36 antibody|CD36 antigen (collagen type I receptor, thrombospondin receptor) antibody|CD36 antigen antibody|CD36 Molecule (thrombospondin receptor) antibody|CD36 Molecule antibody|CD36_HUMAN antibody|CHDS7 antibody|Cluster determinant 36 antibody|Collagen receptor, platelet antibody|FAT antibody| Fatty acid translocase antibody|Fatty acid transport protein antibody|Glycoprotein IIIb antibody|GP IIIb antibody|GP3B antibody|GP4 antibody|GPIIIB antibody|GPIV antibody| Leukocyte differentiation antigen CD36 antibody|MGC108510 antibody|MGC91634 antibody|PAS 4 protein antibody|PAS IV antibody|PAS-4 antibody|PASIV antibody|Platelet collagen receptor antibody|Platelet glycoprotein 4 antibody|Platelet glycoprotein IV antibody|scarb3 antibody|Scavenger receptor class B member 3 antibody|Thrombospondin receptor antibody

ID gène: 948

UniProt: P16671

Pathways: Signalisation TLR, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteins