CHEK2 anticorps (C-Term)

N° du produit ABIN3043811

Détail du produit anti-CHEK2 anticorps

Antigène: CHEK2 (Checkpoint Kinase 2 (CHEK2))

Épitope: AA 465-498, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHEK2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KLLVVDPKAR FTTEEALRHP WLQDEDMKRK FQDL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: checkpoint kinase 2
Protein Name: Serine/threonine-protein kinase Chk2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CHEK2

Antigène: CHEK2 (Checkpoint Kinase 2 (CHEK2))

Autre désignation: CHEK2 (CHEK2 Produits)

Synonymes: anticorps CDS1, anticorps CHK2, anticorps HuCds1, anticorps LFS2, anticorps PP1425, anticorps RAD53, anticorps hCds1, anticorps fa66f08, anticorps wu:fa66f08, anticorps zgc:55865, anticorps Cds1, anticorps HUCDS1, anticorps Rad53, anticorps Chk2, anticorps cds1, anticorps chek2, anticorps chk2, anticorps hucds1, anticorps lfs2, anticorps pp1425, anticorps rad53, anticorps checkpoint kinase 2, anticorps serine/threonine-protein kinase chk2, anticorps checkpoint kinase 2 L homeolog, anticorps CHEK2, anticorps chek2, anticorps Chek2, anticorps MCYG_07308, anticorps chek2.L

Sujet: CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.

Synonyms: bA444G7 antibody|CDS 1 antibody|CDS1 antibody|Checkpoint kinase 2 antibody|Checkpoint like protein CHK2 antibody|Chek 2 antibody|Chek2 antibody|Chk 2 antibody|CHK2 checkpoint homolog (S. pombe) antibody|CHK2 checkpoint homolog antibody|CHK2_HUMAN antibody|HuCds 1 antibody| HuCds1 antibody|LFS 2 antibody|LFS2 antibody|PP1425 antibody|RAD 53 antibody|RAD53 antibody|Rad53 homolog antibody|Serine/threonine protein kinase Chk2 antibody| Serine/ threonine-protein kinase Chk2 antibody

ID gène: 11200

UniProt: O96017

Pathways: Signalisation p53, Apoptose, Cycle Cellulaire