SLC22A2 anticorps (Middle Region)

N° du produit ABIN3043926

Détail du produit anti-SLC22A2 anticorps

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Épitope: AA 524-555, Middle Region

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ETIEEAENMQ RPRKNKEKMI YLQVQKLDIP LN

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 22 (organic cation transporter), member 2
Protein Name: Solute carrier family 22 member 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human , The detection limit for SLC22A2 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SLC22A2

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Autre désignation: SLC22A2 (SLC22A2 Produits)

Synonymes: anticorps OCT2, anticorps Oct2, anticorps Orct2, anticorps OCT2r, anticorps rOCT2, anticorps Pou2f2, anticorps OCT2P, anticorps oct1, anticorps wu:fc01b11, anticorps zgc:64076, anticorps slc22a2, anticorps solute carrier family 22 member 2, anticorps solute carrier family 22 (organic cation transporter), member 2, anticorps POU class 2 homeobox 2, anticorps solute carrier family 22 (organic cation transporter), member 2 L homeolog, anticorps SLC22A2, anticorps Slc22a2, anticorps POU2F2, anticorps LOC521027, anticorps slc22a2, anticorps slc22a2.L

Sujet: SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Synonyms: MGC32628 antibody|OCT 2 antibody|OCT2 antibody|Organic cation transporter 2 antibody|Organic cation transporter antibody|RP11-317M22.2 antibody|Solute carrier family 22 (organic cation transporter) member 2 antibody|Solute carrier family 22 member 2 antibody

ID gène: 6582

UniProt: O15244