SMURF2 anticorps (Middle Region)

N° du produit ABIN3044498

Détail du produit anti-SMURF2 anticorps

Antigène: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Épitope: AA 317-351, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMURF2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human.

Séquence: DHNNRTTQFT DPRLSANLHL VLNRQNQLKD QQQQQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human.
Gene Name: SMAD specific E3 ubiquitin protein ligase 2
Protein Name: E3 ubiquitin-protein ligase SMURF2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SMURF2

Antigène: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Autre désignation: SMURF2 (SMURF2 Produits)

Synonymes: anticorps SMURF2, anticorps 2810411E22Rik, anticorps AI558114, anticorps AI649275, anticorps RGD1310067, anticorps wu:fb82a11, anticorps wu:fc41c02, anticorps SMAD specific E3 ubiquitin protein ligase 2, anticorps SMAD specific E3 ubiquitin protein ligase 2 S homeolog, anticorps SMURF2, anticorps smurf2, anticorps Smurf2, anticorps smurf2.S

Sujet: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression

Synonyms: E3 ubiquitin-protein ligase SMURF2 antibody|EC 6.3.2. antibody|hSMURF2 antibody|MGC138150 antibody|Smad specific E3 ubiquitin ligase 2 antibody|SMAD specific E3 ubiquitin protein ligase 2 antibody|SMAD ubiquitination regulatory factor 2 antibody|SMAD-specific E3 ubiquitin-protein ligase 2 antibody|SMUF2_HUMAN antibody|Smurf2 antibody|Ubiquitin protein ligase SMURF2 antibody

ID gène: 64750