UHRF2 anticorps (N-Term)

N° du produit ABIN3044559

Détail du produit anti-UHRF2 anticorps

Antigène: UHRF2 (Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2))

Épitope: AA 15-54, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UHRF2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: TIEDVSRKAT IEELRERVWA LFDVRPECQR LFYRGKQLEN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Protein Name: E3 ubiquitin-protein ligase UHRF2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur UHRF2

Antigène: UHRF2 (Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2))

Autre désignation: UHRF2 (UHRF2 Produits)

Synonymes: anticorps NIRF, anticorps RNF107, anticorps URF2, anticorps 2310065A22Rik, anticorps AI426270, anticorps AW214556, anticorps D130071B19Rik, anticorps Nirf, anticorps ubiquitin like with PHD and ring finger domains 2, anticorps ubiquitin-like, containing PHD and RING finger domains 2, anticorps ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase L homeolog, anticorps UHRF2, anticorps Uhrf2, anticorps uhrf2.L

Sujet: E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Synonyms: DKFZp434B0920 antibody|DKFZp686G0837 antibody|E3 ubiquitin-protein ligase UHRF2 antibody|MGC33463 antibody|Np95 like RING finger protein antibody|Np95-like ring finger protein antibody|Np95/ICBP90 like RING finger protein antibody|Np95/ICBP90-like RING finger protein antibody|Nuclear protein 97 antibody|Nuclear zinc finger protein Np97 antibody|RING finger protein 107 antibody|RNF 107 antibody|RP11-472F14.2 antibody|Ubiquitin like containing PHD and RING finger domains protein 2 antibody|Ubiquitin-like PHD and RING finger domain-containing protein 2 antibody|Ubiquitin-like-containing PHD and RING finger domains protein 2 antibody|Uhrf2 antibody| UHRF2_HUMAN antibody|URF 2 antibody

ID gène: 115426