TLR8 anticorps (AA 81-109)
-
- Antigène Voir toutes TLR8 Anticorps
- TLR8 (Toll-Like Receptor 8 (TLR8))
-
Épitope
- AA 81-109
-
Reactivité
- Humain
-
Hôte
- Chèvre
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TLR8 est non-conjugé
-
Application
- Western Blotting (WB), Immunocytochemistry (ICC)
- Specificité
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.
- Homologie
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%) Monkey (93%) Marmoset (86%).
- Purification
- Immunoaffinity purified
- Immunogène
-
30 amino acid (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%), Monkey (93%), Marmoset (86%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR8 Anticorps primaire
-
-
- Indications d'application
- Approved: ICC (1:200), WB
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Aliquot to Avoid freeze/thaw cycles.
- Stock
- -20 °C
- Stockage commentaire
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Antigène
- TLR8 (Toll-Like Receptor 8 (TLR8))
- Autre désignation
- TLR8 (TLR8 Produits)
- Synonymes
- anticorps CD288, anticorps toll like receptor 8, anticorps toll-like receptor 8, anticorps TLR8, anticorps Tlr8
- Sujet
-
Name/Gene ID: TLR8
Family: Toll-like Receptor
Synonyms: TLR8, CD288, Toll-like receptor 8, CD288 antigen - ID gène
- 51311
- UniProt
- Q9NR97
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades
-