GADD45A anticorps (C-Term)

N° du produit ABIN4886599

Détail du produit anti-GADD45A anticorps

Antigène: GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))

Épitope: AA 125-165, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GADD45A est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha(GADD45A) detection. Tested with WB in Human.

Séquence: VLVTNPHSSQ WKDPALSQLI CFCRESRYMD QWVPVINLP

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha(GADD45A) detection. Tested with WB in Human.
Gene Name: growth arrest and DNA-damage-inducible, alpha
Protein Name: Growth arrest and DNA damage-inducible protein GADD45 alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human GADD45A (125-165aa VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLP ER), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GADD45A

Antigène: GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))

Autre désignation: GADD45A (GADD45A Produits)

Synonymes: anticorps MGC53491, anticorps zgc:91795, anticorps gadd45a, anticorps GADD45A, anticorps ddit1, anticorps gadd45, anticorps GADD45, anticorps AA545191, anticorps Ddit1, anticorps DDIT1, anticorps Gadd45, anticorps growth arrest and DNA damage inducible alpha L homeolog, anticorps growth arrest and DNA-damage-inducible, alpha, b, anticorps growth arrest and DNA damage inducible alpha, anticorps growth arrest and DNA damage-inducible protein 45, anticorps growth arrest and DNA-damage-inducible 45 alpha, anticorps growth arrest and DNA-damage-inducible, alpha, anticorps gadd45a.L, anticorps gadd45ab, anticorps GADD45A, anticorps gadd45a, anticorps GADD45, anticorps Gadd45a

Sujet: Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.

Synonyms: DDIT1 | DDIT-1 | DDIT1 | GADD45 | GA45A | GADD45A | P24522

ID gène: 1647

UniProt: P24522

Pathways: Signalisation p53, Cycle Cellulaire