Insulin Receptor anticorps (N-Term)

N° du produit ABIN4886636

Détail du produit anti-Insulin Receptor anticorps

Antigène: Insulin Receptor (INSR)

Épitope: AA 38-76, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Insulin Receptor est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Tested with WB in Human,Rat.

Séquence: MDIRNNLTRL HELENCSVIE GHLQILLMFK TRPEDFRDL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Tested with WB in Human,Rat.
Gene Name: insulin receptor
Protein Name: Insulin receptor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Insulin Receptor (38-76aa MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Insulin Receptor (ABIN4886636)

Wang, Sun, Li, Dong, Li, Zhao: "Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." dans: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).

Détails sur Insulin Receptor

Antigène: Insulin Receptor (INSR)

Autre désignation: INSR (INSR Produits)

Synonymes: anticorps CD220, anticorps HHF5, anticorps 4932439J01Rik, anticorps D630014A15Rik, anticorps IR, anticorps IR-A, anticorps IR-B, anticorps 18402, anticorps CG18402, anticorps DIHR, anticorps DILR, anticorps DIR, anticorps DIRH, anticorps DIRbeta, anticorps DInR, anticorps DInr, anticorps Dir-a, anticorps Dir-b, anticorps Dmel\\CG18402, anticorps INR, anticorps INS, anticorps Inr, anticorps Inr-alpha, anticorps Inr-beta, anticorps InsR, anticorps dINR, anticorps dIR, anticorps dIRH, anticorps dInR, anticorps dInr, anticorps dInsR, anticorps dinr, anticorps dir, anticorps er10, anticorps inr, anticorps insulin/insulin-like growth factor receptor, anticorps l(3)05545, anticorps l(3)93Dj, anticorps l(3)er10, anticorps lnR, anticorps ir-A, anticorps CTK-1, anticorps ir, anticorps INSR, anticorps NV14476, anticorps cd220, anticorps hhf5, anticorps insulin receptor, anticorps Insulin-like receptor, anticorps insulin receptor L homeolog, anticorps INSR, anticorps Insr, anticorps InR, anticorps LOC100122567, anticorps LOC100451802, anticorps insr.L

Sujet: INSR(INSULIN RECEPTOR) is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

Synonyms: CD 220 | CD220 | HHF5 | HIR A | insulin receptor | INSR alpha | insulin receptor a | Insulin Receptor alpha | Insulin receptor subunit alpha | Insulin receptor subunit beta | Insulin receptor(IR) | InsulinReceptor | Insulinreceptor(IR) | IR 1 | P06213

ID gène: 3643

UniProt: P06213

Pathways: Signalisation NF-kappaB, Signalisation RTK, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity