PLIN3 anticorps (C-Term)
-
- Antigène Voir toutes PLIN3 Anticorps
- PLIN3 (Perilipin 3 (PLIN3))
-
Épitope
- AA 323-365, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLIN3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- ESRALTMFRD IAQQLQATCT SLGSSIQGLP TNVKDQVQQA
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: perilipin 3
Protein Name: Perilipin-3 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PLIN3 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PLIN3 (Perilipin 3 (PLIN3))
- Autre désignation
- PLIN3 (PLIN3 Produits)
- Synonymes
- anticorps 1300012C15Rik, anticorps M6prbp1, anticorps Tip47, anticorps M6PRBP1, anticorps PP17, anticorps TIP47, anticorps fl05f04, anticorps wu:fl05f04, anticorps m6prbp1, anticorps MGC80328, anticorps PLIN3, anticorps pp17, anticorps tip47, anticorps MGC53750, anticorps perilipin 3, anticorps si:rp71-61h23.4, anticorps perilipin 3 S homeolog, anticorps perilipin 3 L homeolog, anticorps Plin3, anticorps PLIN3, anticorps si:rp71-61h23.4, anticorps plin3.S, anticorps plin3.L
- Sujet
-
Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: M6PRBP 1 | M6PRBP1 | Perilipin 3 | Perilipin3 | Perilipin-3 | PLIN3 | pp17 | Placental protein 17 | TIP47 | O60664 - ID gène
- 10226
- UniProt
- O60664
-