PSMA2 anticorps (Middle Region)

N° du produit ABIN4886705

Détail du produit anti-PSMA2 anticorps

Antigène: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Épitope: AA 82-123, Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.

Séquence: DYRVLVHRAR KLAQQYYLVY QEPIPTAQLV QRVASVMQEY T

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.
Gene Name: proteasome subunit alpha 2
Protein Name: Proteasome subunit alpha type-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PSMA2

Antigène: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Autre désignation: PSMA2 (PSMA2 Produits)

Synonymes: anticorps Lmpc3, anticorps wu:faa49c06, anticorps wu:fb98h03, anticorps zgc:110710, anticorps HC3, anticorps MU, anticorps PMSA2, anticorps PSC2, anticorps proteasome (prosome, macropain) subunit, alpha type 2, anticorps proteasome subunit alpha 2, anticorps proteasome subunit alpha 2 L homeolog, anticorps Psma2, anticorps psma2, anticorps psma2.L, anticorps PSMA2

Sujet: Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.

Synonyms: HC3 | MU | PMSA2 | PSC2 | PSC3 | PSMA 2 | PSMA2 | P25787

ID gène: 5683

UniProt: P25787

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA