c-Rel anticorps

N° du produit ABIN4950367

Détail du produit anti-c-Rel anticorps

Antigène: c-Rel (REL proto-oncogene (c-Rel))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp c-Rel est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the c-Rel antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the c-Rel antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur c-Rel

Antigène: c-Rel (REL proto-oncogene (c-Rel))

Autre désignation: c-Rel / REL (c-Rel Produits)

Synonymes: anticorps C-Rel, anticorps c-Rel, anticorps NFkB, anticorps c-rel, anticorps zgc:100833, anticorps Xrel2, anticorps Xrel3, anticorps rel, anticorps rel-A, anticorps rel2, anticorps rel3, anticorps v-rel, anticorps xrel, anticorps REL proto-oncogene, NF-kB subunit, anticorps reticuloendotheliosis oncogene, anticorps RELA proto-oncogene, NF-kB subunit, anticorps v-rel avian reticuloendotheliosis viral oncogene homolog, anticorps v-rel avian reticuloendotheliosis viral oncogene homolog L homeolog, anticorps ribonuclease A family member 2 pseudogene, anticorps REL, anticorps Rel, anticorps Rela, anticorps rel, anticorps rel.L, anticorps ECRP

Sujet: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

UniProt: P15307