CRY2 anticorps

N° du produit ABIN4950666

Détail du produit anti-CRY2 anticorps

Antigène: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRY2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CRY2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CRY2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CRY2

Antigène: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Autre désignation: CRY2 (CRY2 Produits)

Synonymes: anticorps Cry2, anticorps Cry, anticorps GB10211, anticorps CRY2, anticorps AT-PHH1, anticorps ATCRY2, anticorps CRYPTOCHROME 2 APOPROTEIN, anticorps F19P19.14, anticorps F19P19_14, anticorps FHA, anticorps PHH1, anticorps cryptochrome 2, anticorps HCRY2, anticorps PHLL2, anticorps AV006279, anticorps D130054K12Rik, anticorps gCry2, anticorps cryptochrome circadian regulator 2, anticorps cryptochrome 2, anticorps cryptochrome Cry2, anticorps cryptochrome circadian clock 2, anticorps cryptochrome 2 (photolyase-like), anticorps CRY2, anticorps Cry2, anticorps cry2, anticorps LOC100502533

Sujet: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

UniProt: Q49AN0

Pathways: Response to Water Deprivation, Protein targeting to Nucleus