Endogenous Retrovirus Group 3, Member 1 (ERV3-1) anticorps

Détails pour le produit réf. ABIN4950951
Antigène
  • ERV-R
  • ERV3
  • ERVR
  • HERV-R
  • HERVR
  • envR
  • endogenous retrovirus group 3 member 1, envelope
  • ERV3-1
Reactivité
Humain
24
Hôte
Lapin
17
7
Clonalité
Polyclonal
Conjugué
Inconjugué
3
3
3
3
3
3
Application
Western Blotting (WB)
21
18
16
2
Options
Immunogène Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation ERV3 / ERV3-1 (ERV3-1 Antibody Extrait)
Sujet HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.
UniProt Q14264
Indications d'application Optimal dilution of the ERV3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the ERV3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Endogenous Retrovirus Group 3, Member 1 (ERV3-1) antibody (ABIN4950951) Western blot testing of human 1) HeLa, 2) 22RV1, 3) HepG2, 4) SKOV, 5) A431 and 6) HT...
Avez-vous cherché autre chose?