ERV3 anticorps

N° du produit ABIN4950951

Détail du produit anti-ERV3 anticorps

Antigène: ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERV3 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ERV3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ERV3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ERV3

Antigène: ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))

Autre désignation: ERV3 / ERV3-1 (ERV3-1 Produits)

Synonymes: anticorps ERV-R, anticorps ERV3, anticorps ERVR, anticorps HERV-R, anticorps HERVR, anticorps envR, anticorps endogenous retrovirus group 3 member 1, envelope, anticorps ERV3-1

Sujet: HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

UniProt: Q14264