LGALS8 anticorps

N° du produit ABIN4951132

Détail du produit anti-LGALS8 anticorps

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS8 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Galectin 8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Galectin 8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur LGALS8

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Autre désignation: Galectin 8 (LGALS8 Produits)

Synonymes: anticorps LGALS8, anticorps 1200015E08Rik, anticorps AI326142, anticorps D13Ertd524e, anticorps Lgals-8, anticorps galectin-8, anticorps Gal-8, anticorps PCTA-1, anticorps PCTA1, anticorps Po66-CBP, anticorps xgalectin-VIIIa, anticorps galectin 8, anticorps lectin, galactose binding, soluble 8, anticorps lectin, galactoside binding soluble 8 S homeolog, anticorps LGALS8, anticorps Lgals8, anticorps lgals8.S

Sujet: Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: O00214