Lectin, Galactoside-Binding, Soluble, 8 (LGALS8) anticorps

Détails pour le produit réf. ABIN4951132
Antigène
  • LGALS8
  • 1200015E08Rik
  • AI326142
  • D13Ertd524e
  • Lgals-8
  • galectin-8
  • Gal-8
  • PCTA-1
  • PCTA1
  • Po66-CBP
  • xgalectin-VIIIa
  • galectin 8
  • lectin, galactose binding, soluble 8
  • lectin, galactoside binding soluble 8 S homeolog
  • LGALS8
  • Lgals8
  • lgals8.S
Reactivité
Humain, Rat (Rattus)
123
71
36
6
3
2
2
2
2
1
1
1
1
Hôte
Lapin
131
11
Clonalité
Polyclonal
Conjugué
Inconjugué
10
7
4
4
4
4
4
4
3
3
3
2
1
1
1
1
1
1
Application
Western Blotting (WB)
99
51
51
21
18
16
15
14
13
10
5
3
3
2
2
1
1
Options
Immunogène Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Galectin 8 (LGALS8 Antibody Extrait)
Sujet Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
UniProt O00214
Indications d'application Optimal dilution of the Galectin 8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Galectin 8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lectin, Galactoside-Binding, Soluble, 8 (LGALS8) antibody (ABIN4951132) Western blot testing of 1) rat brain, 2) rat kidney, 3) human placenta, 4) HeLa, 5) A...
Avez-vous cherché autre chose?