Islet Cell Autoantigen 1, 69kDa (ICA1) anticorps

Détails pour le produit réf. ABIN4951392
Antigène
  • ica1
  • MGC52730
  • ICA1
  • DKFZp469G0321
  • zgc:92566
  • 69kDa
  • ICA69
  • Ica69
  • MGC83241
  • ICAp69
  • islet cell autoantigen 1 L homeolog
  • islet cell autoantigen 1
  • Islet cell autoantigen 1
  • islet cell autoantigen 1 S homeolog
  • ica1.L
  • ICA1
  • ica1
  • ica69
  • Ica1
  • ica1.S
Reactivité
Humain, Souris, Rat (Rattus)
80
31
21
4
4
4
3
3
2
2
2
1
1
1
Hôte
Lapin
78
9
Clonalité
Polyclonal
Conjugué
Inconjugué
14
6
6
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
67
38
21
13
7
6
3
3
1
1
1
Options
Immunogène Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation ICA1 (ICA1 Antibody Extrait)
Sujet Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
UniProt Q05084
Indications d'application Optimal dilution of the ICA1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Islet Cell Autoantigen 1, 69kDa (ICA1) antibody (ABIN4951392) Western blot testing of 1) rat brain and 2) mouse pancreas with ICA1 antibody. Predic...
Avez-vous cherché autre chose?