ICA1 anticorps

N° du produit ABIN4951392

Détail du produit anti-ICA1 anticorps

Antigène: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ICA1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ICA1

Antigène: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Autre désignation: ICA1 (ICA1 Produits)

Synonymes: anticorps ica1, anticorps MGC52730, anticorps ICA1, anticorps DKFZp469G0321, anticorps zgc:92566, anticorps 69kDa, anticorps ICA69, anticorps Ica69, anticorps MGC83241, anticorps ICAp69, anticorps islet cell autoantigen 1 L homeolog, anticorps islet cell autoantigen 1, anticorps Islet cell autoantigen 1, anticorps islet cell autoantigen 1 S homeolog, anticorps ica1.L, anticorps ICA1, anticorps ica1, anticorps ica69, anticorps Ica1, anticorps ica1.S

Sujet: Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

UniProt: Q05084