KERA anticorps

N° du produit ABIN4951537

Détail du produit anti-KERA anticorps

Antigène: KERA (Keratocan (KERA))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KERA est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Keratocan antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Keratocan antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KERA

Antigène: KERA (Keratocan (KERA))

Autre désignation: Keratocan (KERA Produits)

Synonymes: anticorps KERA, anticorps si:dkeyp-38g8.3, anticorps zgc:136259, anticorps CNA2, anticorps SLRR2B, anticorps keratocan, anticorps KERA, anticorps kera, anticorps Kera

Sujet: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.

UniProt: O60938

Pathways: Glycosaminoglycan Metabolic Process