Transferrin anticorps

N° du produit ABIN4952904

Détail du produit anti-Transferrin anticorps

Antigène: Transferrin (TF)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Transferrin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin were used as the immunogen for the Transferrin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Transferrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Transferrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Transferrin

Antigène: Transferrin (TF)

Autre désignation: Transferrin (TF Produits)

Synonymes: anticorps ltf, anticorps pro1557, anticorps pro2086, anticorps mgc107777, anticorps LOC692564, anticorps TF, anticorps LOC100144362, anticorps tf, anticorps LTF, anticorps TFEW, anticorps conalbumin, anticorps tf-b, anticorps MGC64306, anticorps PRO1557, anticorps PRO2086, anticorps TFQTL1, anticorps AI266983, anticorps Cd176, anticorps HP, anticorps Tf, anticorps Tfn, anticorps hpx, anticorps Trf, anticorps cb285, anticorps gavi, anticorps id:ibd3238, anticorps id:ibd3525, anticorps sb:cb285, anticorps wu:fb57g06, anticorps wu:fb62h02, anticorps wu:fb63h10, anticorps wu:fb64h10, anticorps zgc:112154, anticorps 143958_at, anticorps CG6186, anticorps Dmel\\CG6186, anticorps TSF1, anticorps anon-EST:Posey265, anticorps tsf1, anticorps Pro-TRH, anticorps IL-5, anticorps STF I, anticorps TRF1, anticorps sTF1, anticorps sTf, anticorps tf1, anticorps transferrin, anticorps serotransferrin, anticorps transferrin (ovotransferrin), anticorps transferrin L homeolog, anticorps melanotransferrin, anticorps transferrin-a, anticorps Transferrin 1, anticorps thyrotropin releasing hormone, anticorps interleukin 5, anticorps TF, anticorps LOC477072, anticorps tf, anticorps Tf, anticorps LOC100144362, anticorps tf.L, anticorps LOC5575625, anticorps Trf, anticorps tfa, anticorps Tsf1, anticorps TRH, anticorps IL5, anticorps LOC101085148, anticorps LOC100726872, anticorps trf

Sujet: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly.

UniProt: P02787

Pathways: Transition Metal Ion Homeostasis