UBE2Q2 anticorps

N° du produit ABIN4953007

Détail du produit anti-UBE2Q2 anticorps

Antigène: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2Q2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the UBE2Q2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the UBE2Q2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur UBE2Q2

Antigène: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Autre désignation: UBE2Q2 (UBE2Q2 Produits)

Synonymes: anticorps 3010021M21Rik, anticorps zgc:56219, anticorps wu:fi34a03, anticorps RGD1307680, anticorps ube2q2, anticorps ubiquitin conjugating enzyme E2 Q2, anticorps ubiquitin-conjugating enzyme E2Q family member 2, anticorps ubiquitin-conjugating enzyme E2 Q2, anticorps ubiquitin conjugating enzyme E2Q family member 2 L homeolog, anticorps UBE2Q2, anticorps Ube2q2, anticorps CpipJ_CPIJ007726, anticorps PTRG_02494, anticorps MGYG_01328, anticorps ube2q2, anticorps ube2q2.L

Sujet: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. It can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.

UniProt: Q8WVN8