Iba1 anticorps (C-Term)

N° du produit ABIN5518728

Détail du produit anti-Iba1 anticorps

Antigène: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Épitope: AA 99-133, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Iba1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.

Séquence: ETFSYPDFLR MMLGKRSAIL KMILMYEEKA REKEK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.
Gene Name: allograft inflammatory factor 1
Protein Name: Allograft inflammatory factor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Iba1 (ABIN5518728)

He, Guo, Xu, Chen, Zhang, Wu, Wang: "Alkaloids from piper longum protect dopaminergic neurons against inflammation-mediated damage induced by intranigral injection of lipopolysaccharide." dans: BMC complementary and alternative medicine, Vol. 16, Issue 1, pp. 412, (2017) (PubMed).

Xiao, Zhang, Zhang, Wang, Chen, Chen, Lv, Shi, Dong: "Re-infection of the prion from the scrapie‑infected cell line SMB-S15 in three strains of mice, CD1, C57BL/6 and Balb/c." dans: International journal of molecular medicine, Vol. 37, Issue 3, pp. 716-26, (2016) (PubMed).

Détails sur Iba1

Antigène: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Autre désignation: AIF1 (IBA1 Produits)

Synonymes: anticorps AIF-1, anticorps IBA1, anticorps IRT-1, anticorps IRT1, anticorps AI607846, anticorps D17H6S50E, anticorps G1, anticorps Iba1, anticorps Bart1, anticorps iba1, anticorps mrf-1, anticorps fa04b11, anticorps wu:fa04b11, anticorps AIF, anticorps AIF1, anticorps aif1, anticorps allograft inflammatory factor 1, anticorps AIF1, anticorps Aif1, anticorps aif1

Sujet: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

Synonyms: AIF 1 | AIF-1 | AIF1 protein | allograft inflammatory factor 1 | G1 | IBA1 | IBA 1 | Iba1 | P55008

ID gène: 199

UniProt: P55008

Pathways: Smooth Muscle Cell Migration