AKAP2 anticorps (C-Term)

N° du produit ABIN5518729

Détail du produit anti-AKAP2 anticorps

Antigène: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Épitope: AA 813-852, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for A-kinase anchor protein 2(AKAP2) detection. Tested with WB in Human,Rat.

Séquence: ETHKSKRRER MDDSSVLEAT RVNRRKSALA LRWEAGIYAN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for A-kinase anchor protein 2(AKAP2) detection. Tested with WB in Human,Rat.
Gene Name: A-kinase anchoring protein 2
Protein Name: A-kinase anchor protein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813-852aa ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur AKAP2

Antigène: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Autre désignation: AKAP2 (AKAP2 Produits)

Synonymes: anticorps AKAP-2, anticorps AKAPKL, anticorps PRKA2, anticorps AA959716, anticorps AI649048, anticorps Akap-2, anticorps Akap-kl, anticorps B230340M18Rik, anticorps Prka2, anticorps akap-kl, anticorps AKAP2, anticorps PALM2, anticorps A-kinase anchoring protein 2, anticorps A kinase (PRKA) anchor protein 2, anticorps A-kinase anchoring protein 2 L homeolog, anticorps A-kinase anchor protein 2, anticorps AKAP2, anticorps Akap2, anticorps akap2.L, anticorps akap2, anticorps LOC101114239

Sujet: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

Synonyms: AKAP 2 | AKAP KL | AKAPKL | KIAA0920 | PRKA 2 | PRKA2 | MISP2 | Q9Y2D5

ID gène: 11217

UniProt: Q9Y2D5