PDE5A anticorps (N-Term)
-
- Antigène Voir toutes PDE5A Anticorps
- PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))
-
Épitope
- AA 20-63, N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDE5A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for cGMP-specific 3',5'-cyclic phosphodiesterase(PDE5A) detection. Tested with WB, IHC-P in Human,Rat.
- Séquence
- QKQQQRDQDS VEAWLDDHWD FTFSYFVRKA TREMVNAWFA ERVH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for cGMP-specific 3',5'-cyclic phosphodiesterase(PDE5A) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: phosphodiesterase 5A
Protein Name: cGMP-specific 3',5'-cyclic phosphodiesterase - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20-63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH), different from the related mouse sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PDE5A Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))
- Autre désignation
- PDE5A (PDE5A Produits)
- Synonymes
- anticorps CGB-PDE, anticorps CN5A, anticorps PDE5, anticorps PDE5A2, anticorps Cgbpde, anticorps Cn5n, anticorps Pde5, anticorps Pde5a1, anticorps PDE5A, anticorps pde5a, anticorps cgb-pde, anticorps cn5a, anticorps pde5, anticorps pde5a1, anticorps phosphodiesterase 5A, anticorps phosphodiesterase 5A, cGMP-specific, anticorps phosphodiesterase 5A S homeolog, anticorps phosphodiesterase 5A, cGMP-specific, b, anticorps PDE5A, anticorps Pde5a, anticorps pde5a.S, anticorps pde5ab, anticorps pde5a
- Sujet
-
CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.
Synonyms: CGB PDE | CGB-PDE | CGBPDE | CN5A | CN5N | PDE 5 | PDE 5A | PDE5 | Pde5a | PDE5A1 | O76074 - ID gène
- 8654
- UniProt
- O76074
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-