PDE5A anticorps (N-Term)

N° du produit ABIN5518785

Détail du produit anti-PDE5A anticorps

Antigène: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Épitope: AA 20-63, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE5A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for cGMP-specific 3',5'-cyclic phosphodiesterase(PDE5A) detection. Tested with WB, IHC-P in Human,Rat.

Séquence: QKQQQRDQDS VEAWLDDHWD FTFSYFVRKA TREMVNAWFA ERVH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for cGMP-specific 3',5'-cyclic phosphodiesterase(PDE5A) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: phosphodiesterase 5A
Protein Name: cGMP-specific 3',5'-cyclic phosphodiesterase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20-63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH), different from the related mouse sequence by eight amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PDE5A

Antigène: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Autre désignation: PDE5A (PDE5A Produits)

Synonymes: anticorps CGB-PDE, anticorps CN5A, anticorps PDE5, anticorps PDE5A2, anticorps Cgbpde, anticorps Cn5n, anticorps Pde5, anticorps Pde5a1, anticorps PDE5A, anticorps pde5a, anticorps cgb-pde, anticorps cn5a, anticorps pde5, anticorps pde5a1, anticorps phosphodiesterase 5A, anticorps phosphodiesterase 5A, cGMP-specific, anticorps phosphodiesterase 5A S homeolog, anticorps phosphodiesterase 5A, cGMP-specific, b, anticorps PDE5A, anticorps Pde5a, anticorps pde5a.S, anticorps pde5ab, anticorps pde5a

Sujet: CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

Synonyms: CGB PDE | CGB-PDE | CGBPDE | CN5A | CN5N | PDE 5 | PDE 5A | PDE5 | Pde5a | PDE5A1 | O76074

ID gène: 8654

UniProt: O76074

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling