AKR1B10 anticorps (C-Term)

N° du produit ABIN5518800

Détail du produit anti-AKR1B10 anticorps

Antigène: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Épitope: AA 285-316, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKR1B10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.

Séquence: EMATILSFNR NWRACNVLQS SHLEDYPFNA EY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.
Gene Name: aldo-keto reductase family 1 member B10
Protein Name: Aldo-keto reductase family 1 member B10

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur AKR1B10

Antigène: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Autre désignation: AKR1B10 (AKR1B10 Produits)

Synonymes: anticorps AKR1B11, anticorps AKR1B12, anticorps ALDRLn, anticorps ARL-1, anticorps ARL1, anticorps HIS, anticorps HSI, anticorps 2310005E10Rik, anticorps Akr1b16, anticorps AKR, anticorps AKR1B10, anticorps Akr1b10, anticorps aldo-keto reductase family 1 member B10, anticorps aldo-keto reductase family 1, member B10 (aldose reductase), anticorps aldo-keto reductase family 1 member B10-like 2, anticorps AKR1B10, anticorps Akr1b10, anticorps AKR1B10L2, anticorps LOC100585902, anticorps LOC100723118, anticorps LOC101107697

Sujet: Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Synonyms: AKR1B10 | AKR1B11 | AKR1B12 | ALDRLn | ARL1 | ARL-1 | ARL 1 | ARP | HIS | HSI | O60218

ID gène: 57016

UniProt: O60218