DVL3 anticorps (Middle Region)

N° du produit ABIN5518827

Détail du produit anti-DVL3 anticorps

Antigène: DVL3 (Dishevelled, Dsh Homolog 3 (Drosophila) (DVL3))

Épitope: AA 397-434, Middle Region

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DVL3 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human,Mouse,Rat.

Séquence: DTERLDDFHL SIHSDMAAIV KAMASPESGL EVRDRMW

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dishevelled segment polarity protein 3
Protein Name: Segment polarity protein dishevelled homolog DVL-3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DVL3

Antigène: DVL3 (Dishevelled, Dsh Homolog 3 (Drosophila) (DVL3))

Autre désignation: DVL3 (DVL3 Produits)

Synonymes: anticorps dsh3, anticorps dvl3, anticorps wu:fb75f04, anticorps wu:fi22h02, anticorps wu:fp61b09, anticorps dishevelled segment polarity protein 3 L homeolog, anticorps dishevelled segment polarity protein 3, anticorps dishevelled segment polarity protein 3a, anticorps dvl3.L, anticorps dvl3, anticorps DVL3, anticorps Dvl3, anticorps dvl3a

Sujet: Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.

Synonyms: Dishevelled 3 | Dishevelled-3 | DSH homolog 3 | dvl3 | KIAA0208 | Q92997

ID gène: 1857

UniProt: Q92997