ETS1 anticorps (N-Term)

N° du produit ABIN5518831

Détail du produit anti-ETS1 anticorps

Antigène: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Épitope: AA 67-98, N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ETS1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Protein C-ets-1(ETS1) detection. Tested with WB in Human,Mouse.

Séquence: KDPRQWTETH VRDWVMWAVN EFSLKGVDFQ KF

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein C-ets-1(ETS1) detection. Tested with WB in Human,Mouse.
Gene Name: ETS proto-oncogene 1, transcription factor
Protein Name: Protein C-ets-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-ETS1 (ABIN5518831)

Bian, Xu, Zhu, Pan, Liu, Luo, Wu, Li: "Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p." dans: PLoS ONE, Vol. 10, Issue 12, pp. e0144877, (2016) (PubMed).

Détails sur ETS1

Antigène: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Autre désignation: ETS1 (ETS1 Produits)

Synonymes: anticorps ETS-1, anticorps EWSR2, anticorps ets1a-a, anticorps XE1-a, anticorps X1-c-ets-1a, anticorps ETS-1A, anticorps ETS-1B, anticorps TNIP1, anticorps c-ets-1, anticorps c-ets1, anticorps Ets-1, anticorps Etsoncb, anticorps Tpl1, anticorps ets1, anticorps ets, anticorps AI196000, anticorps AI448617, anticorps D230050P06, anticorps cb516, anticorps id:ibd1116, anticorps zgc:110573, anticorps XE1-b, anticorps ets-1, anticorps ets1-B, anticorps ETS proto-oncogene 1, transcription factor, anticorps v-ets avian erythroblastosis virus E26 oncogene homolog 1 S homeolog, anticorps v-ets avian erythroblastosis virus E26 oncogene homolog 1, anticorps v-ets erythroblastosis virus E26 oncogene homolog 1 (avian), anticorps E26 avian leukemia oncogene 1, 5' domain, anticorps v-ets avian erythroblastosis virus E26 oncogene homolog 1 L homeolog, anticorps ETS1, anticorps ets1.S, anticorps Ets1, anticorps ets1, anticorps ets1.L

Sujet: Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

Synonyms: ETS 1 | Ets protein | ETS1 | ETS1 protein | EWSR 2 | EWSR2 | FLJ10768 | P54 | P14921

ID gène: 2113

UniProt: P14921