GJC1 anticorps (N-Term)

N° du produit ABIN5518838

Détail du produit anti-GJC1 anticorps

Antigène: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Épitope: AA 91-131, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: YLGYAIHKIA KMEHGEADKK AARSKPYAMR WKQHRALEET E

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: gap junction protein, gamma 1
Protein Name: Gap junction gamma-1 protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-GJC1 (ABIN5518838)

Zeng, Li, Li, Li, Xiao, Chu, Yang: "Effect of Novel Gasotransmitter hydrogen sulfide on renal fibrosis and connexins expression in diabetic rats." dans: Bioengineered, Vol. 7, Issue 5, pp. 314-320, (2017) (PubMed).

Détails sur GJC1

Antigène: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Autre désignation: GJC1 (GJC1 Produits)

Synonymes: anticorps CX45, anticorps GJA7, anticorps cx45, anticorps gja7, anticorps MGC52735, anticorps GJD3, anticorps GJC1, anticorps C130009G16Rik, anticorps Cnx45, anticorps Cx45, anticorps Gja-7, anticorps Gja7, anticorps gap junction protein gamma 1, anticorps gap junction protein gamma 1 L homeolog, anticorps gap junction protein, delta 3, 31.9kDa, anticorps gap junction protein, gamma 1, anticorps Gap junction gamma-1 protein, anticorps GJC1, anticorps gjc1.L, anticorps GJD3, anticorps Gjc1, anticorps gjc1

Sujet: Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.

Synonyms: Gap junction gamma-1 protein | Connexin-45 | Cx45 | Gap junction alpha-7 protein | GJC1 | GJA7 | P36383

ID gène: 10052

UniProt: P36383

Pathways: Cell-Cell Junction Organization