OLR1 anticorps (Middle Region)

N° du produit ABIN5518941

Détail du produit anti-OLR1 anticorps

Antigène: OLR1 (Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1 (OLR1))

Épitope: AA 162-197, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLR1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Oxidized low-density lipoprotein receptor 1(OLR1) detection. Tested with WB in Human.

Séquence: SFNWEKSQEK CLSLDAKLLK INSTADLDFI QQAISY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Oxidized low-density lipoprotein receptor 1(OLR1) detection. Tested with WB in Human.
Gene Name: oxidized low density lipoprotein receptor 1
Protein Name: Oxidized low-density lipoprotein receptor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human LOX-1/OLR1 (162-197aa SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY), different from the related rat sequence by thirteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur OLR1

Antigène: OLR1 (Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1 (OLR1))

Autre désignation: OLR1 (OLR1 Produits)

Synonymes: anticorps OLR1, anticorps LOX1, anticorps Olr1, anticorps CLEC8A, anticorps LOXIN, anticorps SCARE1, anticorps SLOX1, anticorps LOX-1, anticorps SR-EI, anticorps Scare1, anticorps Oldlr1, anticorps Oldr1, anticorps PLOX-1, anticorps oxidized low density lipoprotein receptor 1, anticorps oxidized low density lipoprotein (lectin-like) receptor 1, anticorps OLR1, anticorps Olr1

Sujet: OLR1(oxidized low density lipoprotein (lectin-like) receptor 1) also called CLEC8A, LOX-1, SCARE1, is a receptor protein which belongs to the C-type lectin superfamily. The OLR1 gene encodes a cell-surface endocytosis receptor for oxidized low density lipoprotein (OxLDL). This gene is mapped on 12p13.2. Incubation of the cells with LDL had no effect on LOX1 expression, but incubation with OxLDL resulted in a dose-dependent increase in LOX1 mRNA and protein expression, however, very high concentrations of OxLDL caused a decrease in OxLDL expression, perhaps indicating toxic effects on endothelial cells. LOX1 was also expressed in macrophages, but not in vascular smooth muscle cells. The findings suggested a role for LOX1 in the pathophysiology of atherosclerotic cardiovascular disease. LOX1 expression was detected in all choroidal neovascular membranes, regardless of structure, whereas there was no evidence of LOX1 within the posterior segments of normal eyes. LOX1 plays an active role in the pathogenesis of choroidal neovascularization, especially in ARMD.

Synonyms: Oxidized low-density lipoprotein receptor 1, Ox-LDL receptor 1, C-type lectin domain family 8 member A, Lectin-like oxidized LDL receptor 1, LOX-1, Lectin-like oxLDL receptor 1, hLOX-1, Lectin-type oxidized LDL receptor 1, Oxidized low-density lipoprotein receptor 1, soluble form, OLR1, CLEC8A, LOX1

ID gène: 4973

UniProt: P78380