SLC7A3 anticorps (N-Term)

N° du produit ABIN5518958

Détail du produit anti-SLC7A3 anticorps

Antigène: SLC7A3 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 3 (SLC7A3))

Épitope: AA 1-30, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC7A3 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Cationic amino acid transporter 3(SLC7A3) detection. Tested with WB in Human.

Séquence: MPWQAFRRFG QKLVRRRTLE SGMAETRLAR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cationic amino acid transporter 3(SLC7A3) detection. Tested with WB in Human.
Gene Name: solute carrier family 7 member 3
Protein Name: Cationic amino acid transporter 3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SLC7A3

Antigène: SLC7A3 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 3 (SLC7A3))

Autre désignation: SLC7A3 (SLC7A3 Produits)

Synonymes: anticorps MGC53947, anticorps slc7a3, anticorps wu:fc11h09, anticorps zgc:92563, anticorps atrc3, anticorps cat-3, anticorps ATRC3, anticorps CAT-3, anticorps CAT3, anticorps Atrc3, anticorps SLC7A1, anticorps SLC7A2, anticorps Cat3, anticorps Slc7a2, anticorps solute carrier family 7 member 3 L homeolog, anticorps solute carrier family 7 member 3, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 3a, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 3, anticorps slc7a3.L, anticorps SLC7A3, anticorps slc7a3a, anticorps slc7a3, anticorps Slc7a3

Sujet: Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.

Synonyms: Cationic amino acid transporter 3, CAT-3, CAT3, Cationic amino acid transporter y+, Solute carrier family 7 member 3, SLC7A3, ATRC3, CAT3

ID gène: 84889