IBSP anticorps

N° du produit ABIN5519000

Détail du produit anti-IBSP anticorps

Antigène: IBSP (Integrin-Binding Sialoprotein (IBSP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IBSP est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human,Mouse,Rat.

Séquence: FSMKNLHRRV KIEDSEENGV FKYRPRYYLY KHAYFYPHLK RFPVQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human,Mouse,Rat.
Gene Name: integrin binding sialoprotein
Protein Name: Bone sialoprotein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).

Isotype: IgG

Information d'application

Indications d'application: Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-IBSP (ABIN5519000)

Zhou, Deng, Liu, Li: "Effect of kidney-reinforcing and marrow-beneficial Chinese medicine on bone metabolism-related factors following spinal cord injury in rats." dans: Experimental and therapeutic medicine, Vol. 12, Issue 1, pp. 485-491, (2016) (PubMed).

Cheng, Wang, Zhang, Shi: "The osteogenic potential of mesoporous bioglasses/silk and non-mesoporous bioglasses/silk scaffolds in ovariectomized rats: in vitro and in vivo evaluation." dans: PLoS ONE, Vol. 8, Issue 11, pp. e81014, (2014) (PubMed).

Détails sur IBSP

Antigène: IBSP (Integrin-Binding Sialoprotein (IBSP))

Autre désignation: IBSP (IBSP Produits)

Synonymes: anticorps BNSP, anticorps BSP, anticorps BSP-II, anticorps SP-II, anticorps Bsp, anticorps BSP II, anticorps BSPII, anticorps Bsp2, anticorps IBSP, anticorps integrin binding sialoprotein, anticorps integrin-binding sialoprotein, anticorps integrin-binding sialoprotein S homeolog, anticorps IBSP, anticorps Ibsp, anticorps ibsp.S, anticorps ibsp

Sujet: IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12 % of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1.

Synonyms: Bone sialoprotein 2, Bone sialoprotein II, BSP II, Cell-binding sialoprotein, Integrin-binding sialoprotein, IBSP, BNSP

ID gène: 3381

UniProt: P21815