Thymic Stromal Lymphopoietin anticorps
-
- Antigène Voir toutes Thymic Stromal Lymphopoietin (TSLP) Anticorps
- Thymic Stromal Lymphopoietin (TSLP)
-
Reactivité
- Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Thymic Stromal Lymphopoietin est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for TSLP detection. Tested with WB in Mouse,Rat.
- Séquence
- QEMAQEVQNI CLNQTSQILR LWYSFMQSPE
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for TSLP detection. Tested with WB in Mouse,Rat.
Gene Name: thymic stromal lymphopoietin
Protein Name: Thymic stromal lymphopoietin - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE).
- Isotype
- IgG
- Top Product
- Discover our top product TSLP Anticorps primaire
-
-
- Indications d'application
-
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Thymic Stromal Lymphopoietin (TSLP)
- Autre désignation
- Tslp (TSLP Produits)
- Synonymes
- anticorps TSLP, anticorps thymic stromal lymphopoietin, anticorps TSLP, anticorps Tslp
- Sujet
-
Thymic stromal lymphopoietin, also called TSLP is a protein belonging to the cytokine family. This gene is mapped to 5q22.1. It encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2(TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases.
Synonyms: Thymic stromal lymphopoietin, Thymic stroma-derived lymphopoietin, Tslp - ID gène
- 53603
-