Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

Zinc Finger and BTB Domain Containing 34 (ZBTB34) anticorps Primary Antibody

ZBTB34 Reactivité: Humain IF, IHC (p) Hôte: Lapin Polyclonal
N° du produit ABIN5591145
$577.33
Plus shipping costs $45.00
100 μL
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    Reactivité
    Humain
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Application
    Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit polyclonal antibody raised against recombinant ZBTB34.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: Recombinant protein corresponding to amino acids of human ZBTB34.

    Immunogen Sequence: GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAA

    Isotype
    IgG
  • Indications d'application
    Immunohistochemistry (1:10-1:20)
    Immunofluorescence (1-4 μg/mL)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Antigène
    Autre désignation
    ZBTB34 (ZBTB34 Antibody Extrait)
    Synonymes
    RP11-106H5.1, ZNF918, zinc finger and BTB domain containing 34, ZBTB34
    Sujet
    Full Gene Name: zinc finger and BTB domain containing 34
    Synonyms: FLJ22470,KIAA1993,MGC24652,RP11-106H5.1
    ID gène
    403341
    UniProt
    Q8NCN2
Vous êtes ici: