Zinc Finger and BTB Domain Containing 34 (ZBTB34) anticorps

N° du produit ABIN5591145

Détail du produit

Antigène:

Zinc Finger and BTB Domain Containing 34 (ZBTB34)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit polyclonal antibody raised against recombinant ZBTB34.

Réactivité croisée: Humain

Immunogène:

immunogen: Recombinant protein corresponding to amino acids of human ZBTB34.

Immunogen Sequence: GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAA

Isotype: IgG

Information d'application

Indications d'application: Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 μg/mL)
The optimal working dilution should be determined by the end user.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.

Détail du antigène

Antigène:

Zinc Finger and BTB Domain Containing 34 (ZBTB34)

Autre désignation: ZBTB34 (ZBTB34 Antibody Extrait)

Synonymes: RP11-106H5.1, ZNF918, zinc finger and BTB domain containing 34, ZBTB34

Sujet: Full Gene Name: zinc finger and BTB domain containing 34
Synonyms: FLJ22470,KIAA1993,MGC24652,RP11-106H5.1

ID gène: 403341

UniProt: Q8NCN2