Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

PLG anticorps (Plasminogen) (AA 21-120) Primary Antibody

PLG Reactivité: Humain ELISA, WB Hôte: Souris Monoclonal 2A10 unconjugated
Pubmed (1)
N° du produit ABIN562271
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    PLG
    Épitope
    AA 21-120
    Reactivité
    Humain
    Hôte
    Souris
    Clonalité
    Monoclonal
    Conjugué
    Cet anticorp PLG est non-conjugé
    Application
    ELISA, Western Blotting (WB)
    Fonction
    Mouse monoclonal antibody raised against a partial recombinant PLG.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: PLG (AAH60513, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: PLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN

    Clone
    2A10
    Isotype
    IgG1 kappa
  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Jeon, Jeong, Baek, Koo, Park, Yang, Yu, Kim, Pak: "Network clustering revealed the systemic alterations of mitochondrial protein expression." dans: PLoS computational biology, Vol. 7, Issue 6, pp. e1002093, 2011 (PubMed).

  • Antigène
    PLG
    Autre désignation
    PLG (PLG Antibody Extrait)
    Synonymes
    wu:fb70e09, PLG, LPA, plg, Ab1-346, AI649309, Pg, plasminogen, plg, PLG, Plg
    Sujet
    Full Gene Name: plasminogen
    Synonyms: DKFZp779M0222
    ID gène
    5340
    Pathways
    Système du Complément, Lipid Metabolism
Vous êtes ici: