Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

PLG anticorps (Plasminogen) (AA 1-810) Primary Antibody

PLG Reactivité: Humain IP, WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN948269
$425.71
Plus shipping costs $45.00
100 μL
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    PLG
    Épitope
    AA 1-810
    Reactivité
    Humain
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Conjugué
    Cet anticorp PLG est non-conjugé
    Application
    Immunoprecipitation (IP), Western Blotting (WB)
    Fonction
    Rabbit polyclonal antibody raised against a full-length human PLG protein.
    Marque
    MaxPab®
     Réactivité croisée
    Humain
    Immunogène

    immunogen: PLG (NP_000292.1, 1 a.a. ~ 810 a.a) full-length human protein.

    Immunogen Sequence: MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN

  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Agent conservateur
    Without preservative
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Antigène
    PLG
    Autre désignation
    PLG (PLG Antibody Extrait)
    Synonymes
    wu:fb70e09, PLG, LPA, plg, Ab1-346, AI649309, Pg, plasminogen, plg, PLG, Plg
    Sujet
    Full Gene Name: plasminogen
    Synonyms: DKFZp779M0222
    ID gène
    5340
    NCBI Accession
    NP_000292, NM_000301
    Pathways
    Système du Complément, Lipid Metabolism
Vous êtes ici: