Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Insulin Receptor anticorps (AA 38-76)

Cet anticorps Lapin Polyclonal détecte spécifiquement Insulin Receptor dans WB. Il présente une réactivité avec des échantillons de Humain et Rat.
N° du produit ABIN5647071
644,88 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 6 à 8 jours ouvrables

Aperçu rapide pour Insulin Receptor anticorps (AA 38-76) (ABIN5647071)

Antigène

Voir toutes Insulin Receptor (INSR) Anticorps
Insulin Receptor (INSR)

Reactivité

  • 208
  • 109
  • 100
  • 16
  • 12
  • 8
  • 7
  • 6
  • 6
  • 6
  • 4
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Humain, Rat

Hôte

  • 177
  • 43
  • 6
  • 2
  • 1
Lapin

Clonalité

  • 145
  • 84
Polyclonal

Conjugué

  • 135
  • 17
  • 16
  • 7
  • 6
  • 5
  • 4
  • 4
  • 4
  • 4
  • 4
  • 4
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Cet anticorp Insulin Receptor est non-conjugé

Application

  • 157
  • 77
  • 73
  • 33
  • 29
  • 28
  • 22
  • 16
  • 13
  • 13
  • 9
  • 5
  • 4
  • 4
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Épitope

    • 16
    • 13
    • 13
    • 11
    • 8
    • 8
    • 8
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 38-76

    Purification

    Antigen affinity purified

    Immunogène

    Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

    Isotype

    IgG
  • Indications d'application

    Western blot: 0.5-1 μg/mL

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Stock

    -20 °C

    Stockage commentaire

    After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène

    Insulin Receptor (INSR)

    Autre désignation

    Insulin Receptor / INSR

    Sujet

    Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

    UniProt

    P06213

    Pathways

    Signalisation NF-kappaB, Signalisation RTK, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity
Vous êtes ici:
Chat with us!