Insulin Receptor anticorps (AA 38-76)

N° du produit ABIN5647071

Cet anticorps Lapin Polyclonal détecte spécifiquement Insulin Receptor dans WB. Il présente une réactivité envers Humain et Rat.

Aperçu rapide pour Insulin Receptor anticorps (AA 38-76) (ABIN5647071)

Antigène: Insulin Receptor (INSR)

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Insulin Receptor est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Insulin Receptor anticorps

Épitope: AA 38-76

Purification: Antigen affinity purified

Immunogène: Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Insulin Receptor

Antigène: Insulin Receptor (INSR)

Autre désignation: Insulin Receptor / INSR

Sujet: Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

UniProt: P06213

Pathways: Signalisation NF-kappaB, Signalisation RTK, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity