AMHR2 anticorps
-
- Antigène Voir toutes AMHR2 Anticorps
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AMHR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product AMHR2 Anticorps primaire
-
-
- Indications d'application
- Western blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- Prior to reconstitution, store at 4°C. After reconstitution, the AMHR2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
- Autre désignation
- AMHR2 (AMHR2 Produits)
- Synonymes
- anticorps AMHR, anticorps MISR2, anticorps MISRII, anticorps MRII, anticorps Misiir, anticorps Misrii, anticorps Mrii, anticorps anti-Mullerian hormone receptor type 2, anticorps anti-Mullerian hormone type 2 receptor, anticorps AMHR2, anticorps Amhr2
- Classe de substances
- Antibody
- Sujet
- AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
- UniProt
- Q16671
-