AMHR2 anticorps

N° du produit ABIN5647325

Détail du produit anti-AMHR2 anticorps

Antigène: AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMHR2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the AMHR2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur AMHR2

Antigène: AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))

Autre désignation: AMHR2 (AMHR2 Produits)

Synonymes: anticorps AMHR, anticorps MISR2, anticorps MISRII, anticorps MRII, anticorps Misiir, anticorps Misrii, anticorps Mrii, anticorps anti-Mullerian hormone receptor type 2, anticorps anti-Mullerian hormone type 2 receptor, anticorps AMHR2, anticorps Amhr2

Classe de substances: Antibody

Sujet: AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: Q16671