Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

BAX anticorps (AA 17-48)

Cet anticorps Lapin Polyclonal détecte spécifiquement BAX dans WB, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris et Rat.
N° du produit ABIN5647494
644,88 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 6 à 9 jours ouvrables

Aperçu rapide pour BAX anticorps (AA 17-48) (ABIN5647494)

Antigène

Voir toutes BAX Anticorps
BAX (BCL2-Associated X Protein (BAX))

Reactivité

  • 261
  • 168
  • 148
  • 45
  • 28
  • 27
  • 23
  • 19
  • 16
  • 11
  • 10
  • 8
  • 4
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Humain, Souris, Rat

Hôte

  • 166
  • 103
  • 3
  • 2
  • 1
Lapin

Clonalité

  • 164
  • 111
Polyclonal

Conjugué

  • 145
  • 14
  • 11
  • 9
  • 7
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Cet anticorp BAX est non-conjugé

Application

  • 234
  • 95
  • 91
  • 76
  • 53
  • 52
  • 51
  • 47
  • 39
  • 14
  • 12
  • 8
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Épitope

    • 32
    • 25
    • 19
    • 17
    • 15
    • 12
    • 10
    • 10
    • 8
    • 8
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 17-48

    Purification

    Antigen affinity purified

    Immunogène

    Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

    Isotype

    IgG
  • Indications d'application

    Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Stock

    -20 °C

    Stockage commentaire

    After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène

    BAX (BCL2-Associated X Protein (BAX))

    Autre désignation

    Bax

    Sujet

    Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

    UniProt

    Q07812

    Pathways

    Signalisation p53, Signalisation PI3K-Akt, Apoptose, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
Vous êtes ici:
Chat with us!