CHRNA5 anticorps (AA 44-76)

N° du produit ABIN5647951

Détail du produit anti-CHRNA5 anticorps

Antigène: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Épitope: AA 44-76

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 44-76 (AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF) from the human protein were used as the immunogen for the CHRNA5 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CHRNA5 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CHRNA5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CHRNA5

Antigène: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Autre désignation: CHRNA5 (CHRNA5 Produits)

Synonymes: anticorps zgc:110642, anticorps LNCR2, anticorps Acra-5, anticorps Acra5, anticorps cholinergic receptor, nicotinic, alpha 5, anticorps cholinergic receptor nicotinic alpha 5 subunit, anticorps cholinergic receptor nicotinic alpha 5 subunit L homeolog, anticorps cholinergic receptor, nicotinic, alpha polypeptide 5, anticorps chrna5, anticorps CHRNA5, anticorps chrna5.L, anticorps Chrna5

Sujet: Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).

UniProt: P30532