SLC31A1 anticorps

N° du produit ABIN5693022

Détail du produit anti-SLC31A1 anticorps

Antigène: SLC31A1 (Solute Carrier Family 31 (Copper Transporters), Member 1 (SLC31A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC31A1 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: NGTILMETHK TVGQQMLSFP HLLQTVLHII Q

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for SLC31A1/CTR1 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur SLC31A1

Antigène: SLC31A1 (Solute Carrier Family 31 (Copper Transporters), Member 1 (SLC31A1))

Autre désignation: SLC31A1 (SLC31A1 Produits)

Synonymes: anticorps SLC31A1, anticorps Xctr1, anticorps copt1, anticorps ctr1, anticorps hctr1, anticorps K19M22.24, anticorps copper transporter 1, anticorps Slc31a1, anticorps COPT1, anticorps CTR1, anticorps Ctr1, anticorps LRRGT00200, anticorps ctr-1, anticorps zgc:76839, anticorps 4930445G01Rik, anticorps AI787263, anticorps AU016967, anticorps solute carrier family 31 member 1, anticorps copper transporter 1, anticorps solute carrier family 31 (copper transporter), member 1, anticorps solute carrier family 31, member 1, anticorps SLC31A1, anticorps LOC100281410, anticorps LOC100286321, anticorps slc31a1, anticorps COPT1, anticorps Slc31a1

Sujet:

Synonyms: High affinity copper uptake protein 1, Copper transporter 1, hCTR1, Solute carrier family 31 member 1, SLC31A1, COPT1, CTR1

Background: High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.

UniProt: O15431