MUC2 anticorps

N° du produit ABIN5693242

Détail du produit anti-MUC2 anticorps

Antigène: MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming (MUC2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MUC2 est non-conjugé

Application: Immunohistochemistry (IHC)

Séquence: DDFKTASGLV EATGAGFANT WKAQSTCHDK LDWLDD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for MUC2 detection. Tested with IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

Information d'application

Indications d'application:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur MUC2

Antigène: MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming (MUC2))

Autre désignation: MUC2 (MUC2 Produits)

Synonymes: anticorps 2010015E03Rik, anticorps MCM, anticorps wnn, anticorps MLP, anticorps MUC-2, anticorps SMUC, anticorps HH-Muc, anticorps mucin 2, anticorps mucin 2, oligomeric mucus/gel-forming, anticorps mucin-2, anticorps Muc2, anticorps MUC2, anticorps LOC100724045

Sujet:

Synonyms: Mucin-2, MUC-2, Intestinal mucin-2, MUC2, SMUC

Tissue Specificity: Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.

Background: Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80 % by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.

UniProt: Q02817