NAMPT anticorps (C-Term)

N° du produit ABIN629601

Détail du produit anti-NAMPT anticorps

Antigène: NAMPT (Nicotinamide phosphoribosyltransferase (NAMPT))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAMPT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PBEF1 antibody was raised against the C terminal of PBEF1

Purification: Purified

Immunogène: PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PBEF1 Blocking Peptide, catalog no. 33R-9851, is also available for use as a blocking control in assays to test for specificity of this PBEF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAMPT

Antigène: NAMPT (Nicotinamide phosphoribosyltransferase (NAMPT))

Autre désignation: PBEF1 (NAMPT Produits)

Synonymes: anticorps 1110035O14Rik, anticorps PBEF, anticorps PBEF1, anticorps VF, anticorps VISFATIN, anticorps AI314458, anticorps AI480535, anticorps NAmPRTase, anticorps Pbef, anticorps Pbef1, anticorps Visfatin, anticorps visfatin, anticorps pbef, anticorps pbef1, anticorps nicotinamide phosphoribosyltransferase, anticorps Nicotinamide phosphoribosyltransferase, anticorps nicotinamide phosphoribosyltransferase S homeolog, anticorps NAMPT, anticorps Nampt, anticorps nampt, anticorps Smon_0680, anticorps Mrub_2845, anticorps Cseg_3704, anticorps BC1002_3997, anticorps Ftrac_2686, anticorps Varpa_5681, anticorps Celal_3900, anticorps Deima_0880, anticorps BC1001_3724, anticorps Celly_1696, anticorps Clole_1542, anticorps Tsp_05934, anticorps nampt.S

Sujet: PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

Poids moléculaire: 54 kDa (MW of target protein)