NUDT12 anticorps

N° du produit ABIN629616

Détail du produit anti-NUDT12 anticorps

Antigène: NUDT12 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUDT12 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUDT12 Blocking Peptide, catalog no. 33R-4782, is also available for use as a blocking control in assays to test for specificity of this NUDT12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUDT12

Antigène: NUDT12 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12))

Autre désignation: NUDT12 (NUDT12 Produits)

Synonymes: anticorps 0610016O18Rik, anticorps nudix (nucleoside diphosphate linked moiety X)-type motif 12, anticorps peroxisomal NADH pyrophosphatase NUDT12, anticorps NADH pyrophosphatase, anticorps nudix hydrolase 12, anticorps nudt12, anticorps BCAN_A0038, anticorps BSUIS_A0039, anticorps SJAG_03091, anticorps BMEA_A0038, anticorps PAAG_04340, anticorps MCYG_01870, anticorps MGYG_04196, anticorps NUDT12, anticorps Nudt12

Sujet: Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.

Poids moléculaire: 52 kDa (MW of target protein)