EIF2S3 anticorps (N-Term)
-
- Antigène Voir toutes EIF2S3 Anticorps
- EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF2S3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF2 S3 antibody was raised against the N terminal of EIF2 3
- Purification
- Purified
- Immunogène
- EIF2 S3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
- Top Product
- Discover our top product EIF2S3 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF2S3 Blocking Peptide, catalog no. 33R-4841, is also available for use as a blocking control in assays to test for specificity of this EIF2S3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))
- Autre désignation
- EIF2S3 (EIF2S3 Produits)
- Synonymes
- anticorps EIF2, anticorps EIF2G, anticorps EIF2gamma, anticorps eIF-2gA, anticorps Su(var)3-9, anticorps fi03g03, anticorps wu:fi03g03, anticorps wu:fi37d04, anticorps zgc:63805, anticorps EIF2S3, anticorps eif2, anticorps eif2g, anticorps eif2s3y, anticorps eif2gamma, anticorps Eif2g, anticorps Eif2s3, anticorps PP42, anticorps ENSMUSG00000079297, anticorps eukaryotic translation initiation factor 2 subunit gamma, anticorps eukaryotic translation initiation factor 2, subunit 3 gamma, anticorps eukaryotic translation initiation factor 2 subunit gamma S homeolog, anticorps putative eukaryotic translation initiation factor 2 subunit 3-like protein, anticorps eukaryotic translation initiation factor 2 subunit 3, anticorps predicted pseudogene 2223, anticorps EIF2S3, anticorps eif2s3, anticorps eif2s3.S, anticorps LOC738402, anticorps LOC100179499, anticorps LOC100624149, anticorps Eif2s3, anticorps Gm2223
- Sujet
- EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
- Poids moléculaire
- 51 kDa (MW of target protein)
-