EIF2S3 anticorps (N-Term)

N° du produit ABIN629631

Détail du produit anti-EIF2S3 anticorps

Antigène: EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2S3 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 S3 antibody was raised against the N terminal of EIF2 3

Purification: Purified

Immunogène: EIF2 S3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2S3 Blocking Peptide, catalog no. 33R-4841, is also available for use as a blocking control in assays to test for specificity of this EIF2S3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2S3

Antigène: EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))

Autre désignation: EIF2S3 (EIF2S3 Produits)

Synonymes: anticorps EIF2, anticorps EIF2G, anticorps EIF2gamma, anticorps eIF-2gA, anticorps Su(var)3-9, anticorps fi03g03, anticorps wu:fi03g03, anticorps wu:fi37d04, anticorps zgc:63805, anticorps EIF2S3, anticorps eif2, anticorps eif2g, anticorps eif2s3y, anticorps eif2gamma, anticorps Eif2g, anticorps Eif2s3, anticorps PP42, anticorps ENSMUSG00000079297, anticorps eukaryotic translation initiation factor 2 subunit gamma, anticorps eukaryotic translation initiation factor 2, subunit 3 gamma, anticorps eukaryotic translation initiation factor 2 subunit gamma S homeolog, anticorps putative eukaryotic translation initiation factor 2 subunit 3-like protein, anticorps eukaryotic translation initiation factor 2 subunit 3, anticorps predicted pseudogene 2223, anticorps EIF2S3, anticorps eif2s3, anticorps eif2s3.S, anticorps LOC738402, anticorps LOC100179499, anticorps LOC100624149, anticorps Eif2s3, anticorps Gm2223

Sujet: EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Poids moléculaire: 51 kDa (MW of target protein)