RNF38 anticorps (N-Term)

N° du produit ABIN629634

Détail du produit anti-RNF38 anticorps

Antigène: RNF38 (Ring Finger Protein 38 (RNF38))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF38 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF38 antibody was raised against the N terminal of RNF38

Purification: Purified

Immunogène: RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF38 Blocking Peptide, catalog no. 33R-2874, is also available for use as a blocking control in assays to test for specificity of this RNF38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF38

Antigène: RNF38 (Ring Finger Protein 38 (RNF38))

Autre désignation: RNF38 (RNF38 Produits)

Synonymes: anticorps 1700065B19Rik, anticorps 2610202O07Rik, anticorps AA673263, anticorps Oip1, anticorps ring finger protein 38 L homeolog, anticorps ring finger protein 38, anticorps rnf38.L, anticorps RNF38, anticorps Rnf38

Sujet: RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.

Poids moléculaire: 51 kDa (MW of target protein)