NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) anticorps
-
- Antigène Voir toutes NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) Anticorps
- NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- NELF antibody was raised against the middle region of NELF
- Purification
- Purified
- Immunogène
- NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG
- Top Product
- Discover our top product NSMF Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NELF Blocking Peptide, catalog no. 33R-7887, is also available for use as a blocking control in assays to test for specificity of this NELF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)
- Autre désignation
- NELF (NSMF Produits)
- Synonymes
- anticorps HH9, anticorps NELF, anticorps NMDA receptor synaptonuclear signaling and neuronal migration factor, anticorps NSMF
- Sujet
- NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-