LKB1 anticorps (N-Term)

N° du produit ABIN629708

Détail du produit anti-LKB1 anticorps

Antigène: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LKB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: STK11 antibody was raised against the N terminal of STK11

Purification: Purified

Immunogène: STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STK11 Blocking Peptide, catalog no. 33R-9160, is also available for use as a blocking control in assays to test for specificity of this STK11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LKB1

Antigène: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Autre désignation: STK11 (STK11 Produits)

Synonymes: anticorps pjs, anticorps LKB1, anticorps XEEK1, anticorps Stk11, anticorps PJS, anticorps hLKB1, anticorps AA408040, anticorps Lkb1, anticorps Par-4, anticorps R75140, anticorps mLKB1, anticorps wu:fj61a05, anticorps zgc:110180, anticorps xeek1, anticorps serine/threonine kinase 11, anticorps polarization-related protein LKB1, anticorps serine/threonine kinase 11 L homeolog, anticorps STK11, anticorps stk11, anticorps LOC662493, anticorps Stk11, anticorps stk11.L

Sujet: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg