AMFR anticorps (C-Term)

N° du produit ABIN629722

Cet anticorps Lapin Polyclonal détecte spécifiquement AMFR dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour AMFR anticorps (C-Term) (ABIN629722)

Antigène: AMFR (Autocrine Motility Factor Receptor (AMFR))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMFR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AMFR anticorps

Épitope: C-Term

Specificité: AMFR antibody was raised against the C terminal of AMFR

Purification: Purified

Immunogène: AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMFR Blocking Peptide, (ABIN938287), is also available for use as a blocking control in assays to test for specificity of this AMFR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMFR

Antigène: AMFR (Autocrine Motility Factor Receptor (AMFR))

Autre désignation: AMFR

Sujet: Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling