AMFR anticorps (C-Term)

N° du produit ABIN629722

Détail du produit anti-AMFR anticorps

Antigène: AMFR (Autocrine Motility Factor Receptor (AMFR))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMFR est non-conjugé

Application: Western Blotting (WB)

Specificité: AMFR antibody was raised against the C terminal of AMFR

Purification: Purified

Immunogène: AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMFR Blocking Peptide, catalog no. 33R-2901, is also available for use as a blocking control in assays to test for specificity of this AMFR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMFR

Antigène: AMFR (Autocrine Motility Factor Receptor (AMFR))

Autre désignation: AMFR (AMFR Produits)

Synonymes: anticorps GP78, anticorps RNF45, anticorps gp78, anticorps wu:fi06e06, anticorps wu:fi37e05, anticorps zgc:63893, anticorps rnf45, anticorps autocrine motility factor receptor, anticorps autocrine motility factor receptor L homeolog, anticorps autocrine motility factor receptor a, anticorps autocrine motility factor receptor, amfr, anticorps putative autocrine motility factor receptor, amfr, anticorps AMFR, anticorps Amfr, anticorps amfr.L, anticorps amfra, anticorps amfr, anticorps AaeL_AAEL005881, anticorps CpipJ_CPIJ016043, anticorps Smp_047420

Sujet: Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling