UBR7 anticorps (Middle Region)
-
- Antigène Voir toutes UBR7 Anticorps
- UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBR7 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- C14 ORF130 antibody was raised against the middle region of C14 rf130
- Purification
- Purified
- Immunogène
- C14 ORF130 antibody was raised using the middle region of C14 rf130 corresponding to a region with amino acids MIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAV
- Top Product
- Discover our top product UBR7 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C14ORF130 Blocking Peptide, catalog no. 33R-6118, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))
- Autre désignation
- C14ORF130 (UBR7 Produits)
- Synonymes
- anticorps C14orf130, anticorps 5730410I19Rik, anticorps AA589405, anticorps AW557761, anticorps RGD1359144, anticorps ubiquitin protein ligase E3 component n-recognin 7 (putative), anticorps UBR7, anticorps Ubr7
- Sujet
- C14ORF130 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. C14ORF130 recognises and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
- Poids moléculaire
- 47 kDa (MW of target protein)
-