PTGER3 anticorps

N° du produit ABIN629769

Détail du produit anti-PTGER3 anticorps

Antigène: PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGER3 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER

Information d'application

Indications d'application: WB: 2.4 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTGER3 Blocking Peptide, catalog no. 33R-4856, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGER3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGER3

Antigène: PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))

Autre désignation: PTGER3 (PTGER3 Produits)

Synonymes: anticorps PTGER3, anticorps EP3, anticorps EP3-I, anticorps EP3-II, anticorps EP3-III, anticorps EP3-IV, anticorps EP3e, anticorps PGE2-R, anticorps PTGEREP3, anticorps Rep3, anticorps rEP3a, anticorps rEP3b, anticorps Pgerep3, anticorps Ptgerep3, anticorps prostaglandin E receptor 3, anticorps prostaglandin E receptor 3 L homeolog, anticorps prostaglandin E receptor 3 (subtype EP3), anticorps PTGER3, anticorps ptger3.L, anticorps Ptger3

Sujet: PTGER3 is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli.

Poids moléculaire: 43 kDa (MW of target protein)