KYNU anticorps

N° du produit ABIN629834

Détail du produit anti-KYNU anticorps

Antigène: KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KYNU est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KYNU Blocking Peptide, catalog no. 33R-5947, is also available for use as a blocking control in assays to test for specificity of this KYNU antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KYNU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KYNU

Antigène: KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))

Autre désignation: KYNU (KYNU Produits)

Synonymes: anticorps BA2753, anticorps 4432411A05Rik, anticorps Kynureninase, anticorps kynureninase, anticorps kynureninase (L-kynurenine hydrolase), anticorps kynu-1, anticorps kynU, anticorps CNC03980, anticorps Mrub_2118, anticorps Ndas_0787, anticorps Trad_2365, anticorps Ftrac_2835, anticorps Celal_2292, anticorps Deima_1563, anticorps Celly_0597, anticorps Deipr_2230, anticorps Fluta_1605, anticorps Halhy_3696, anticorps Mesop_4277, anticorps KYNU, anticorps Kynu

Sujet: Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.

Poids moléculaire: 52 kDa (MW of target protein)